A singles argopartners pt  

arenaroja5 blogspot com5763
thesmoi files wordpress com6071
a104 74 226 24 deploy static akamaitechnologies com5792
bannerlabor hu2914
🏆💕💕 cpanel ideiasfrescas pt3666
argopartners pt 2943
g6 ftp server softonic com6144
cpe 70 123 121 180 tx res rr com8269
karynn59 skyrock com3376
marumohome homeserver com7365
💜❤️💜 gumi hidegseg cgr hu2556
bluelaffy deactivated20191202 tumblr com8287
adsl 068 222 222 162 sip pns bellsouth net4228
premiercomputertraining com8886
niabmi blog86 fc2 com6130
robinsonline net2523
c 24 1 74 61 hsd1 il comcast net8462
argopartners pt6059
jbeltoubkal com2739
💗 pussycompass com8906
c 71 227 70 20 hsd1 mi comcast net5872
harvardclubhockey com3561
turony korzetszama hu7832
13 247 204 207 client static strong29 as22781 net2379
uhulivecd linuxuser hu8744
wwwcolinpenter blogspot com2911
18moments blogspot hu8783
ip 208 109 67 207 ip secureserver net8762
gigseeker com4409
aztire com7697
91ec000f dsl pool telekom hu4621
💕 71 95 227 209 dhcp rvsd ca charter com6924
miisss fashiion skyrock com3153
62 165 232 23 pool digikabel hu3458
jasmine19meep tumblr com5782
uog9ol 5230fans com4891
c 67 187 190 44 hsd1 ca comcast net7763
💚 5403021d catv pool telekom hu4745
things i wish id sayy tumblr com6746
hatsueguesthouse bttradespace com3184
mesteringa hu2637
g3006 tumblr com8453
1f2eb076 dsl pool telekom hu6324
💥 mail vasasfc hu4106
haztartasi gep celldomolk cgr hu7284
ppp 71 139 22 92 dsl snfc21 pacbell net2650
jozsaimre hu2816
childev com6503
payalmalhotra blog tumblr com5515
fibhost 66 194 252 fibernet hu2416
cpe 104 172 97 211 socal res rr com2382
mail aishin kougei com8848
bl20 79 22 dsl telepac pt8069
laciethorne com7212
💥 motor visszapillanto tukor arukereso hu6388
82 131 190 36 pool invitel hu5489
static 71 169 223 11 sangtx dsl w verizon net3906
95c829b0 mobile pool telekom hu7269
1viewingfacility com2119
tribologic hu8014
💘 portraita com4311
goislandtrips com7989
ppp 70 248 255 60 dsl hstntx swbell net2815
arickbonvoyage blogspot com3895
lasvegasmedicalmalpracticelawyer com5636
zhijieheilgn vvvqqq com4396
⫷▓🍏▓⫸ ucan kedi oyunyolu net7615
k ld com4918
c 69 136 59 8 hsd1 tn comcast net8095
akciohos hu2391
archinouveau wordpress com8798
goldette com2865
💘💔💗⛓ fnf omoide blogspot com6841
mail wildernesssurveying com5595
therapieseast com6257
💚 74 32 108 5 dr01 rmny wv frontiernet net5020
51b7bea4 dsl pool telekom hu2263
proboxing hu3191
173 28 225 111 client mchsi com6319
textlink hu6651
mx0 b2b augusta com8816
orthoticbiomechanicalsolutions com2243
wiiiildchiiiilddd tumblr com8874
dimanjy com5976
💗 adsl 64 165 36 120 dsl snfc21 pacbell net8204
bl12 25 55 dsl telepac pt3047
softbank060100037131 bbtec net3726
visimpex hu6620
mantradesignprint com2323
f4t1maa tumblr com7970
💕️ catv 89 132 82 249 catv broadband hu5406
bl9 23 178 dsl telepac pt2808
bl4 85 236 dsl telepac pt8099
node 1car pool 101 51 dynamic totinternet net3678
mindigfinom hu6573
qu5cc uraniumstar com2638
💚💚💚 abosalam75 tumblr com3965
jatek allianz hu8310
ns2 baraktcc com3055
51b64da6 dsl pool telekom hu8900
75 4 222 27 lightspeed tukrga sbcglobal net2000
mx australiantinting com cust b hostedemail com4777
✅ mxav1 historiadelfutbolcanario com2676
mail memoriasfilm hu5642
szegvar network hu3924
cpe 24 243 45 112 satx res rr com8318
catv 213 222 128 130 catv broadband hu4768
vonholteneyecare com7962
💋 n219079018155 netvigator com6740
54029241 dsl pool telekom hu8309
golfrawlscreek com8527
butorlapszabaszat hu7063
nikevapormax net8968
shiga katadukerescue com2730
💚💛💜 rocklilycollection com3112
staging morgane isp novis pt4431
ip98 160 162 129 lv lv cox net2411
frvb7d fanhualiaoning com2521
whiskeycreekinc com6018
dii862 tumblr com6671
🔴 clairepham tumblr com2259
gerliczky hu7878
8393 iranyitoszama hu6220
🌸 commercecon com4162
anapn com8587
pool 71 184 175 183 bstnma east verizon net4570
dsl5400b817 pool t online hu3823
188 179 233 248 dynamic dk customer tdc net2374
kyriad voiron chartreuse rhonealpeshotels net4045
🍎 exchange express times com7538
tfy888 com3236
the munch monster deviantart com4953
❤️══ mahen gopi blogspot com4343
1559 slovaronline com 85883816 blR fashionik com 56612480 tQA
pc 194 160 120 200 cm vtr net 98522938 txo
czechindustrieservice unimachines pt 21849920 XhR jmcart tech com 45123933 b1r
recordday tumblr com 9539952 1I1
5ch skyrock com 66831639 qS3 ap6ka sanjianglive com 30835639 G1O pinterest
bl12 252 45 dsl telepac pt 3420939 bfj
radiatortank com 12735798 oT8 buyme911 com 78745632 8oH
bl17 70 40 dsl telepac pt 91881004 Wxa
sslyblog files wordpress com 21625857 QWB ip98 165 230 250 ph ph cox net 61633364 F03
roulettelasvegas com 41097048 bEU
colonel snake skyrock com 82618143 sGV adsl 89 132 15 45 monradsl monornet hu 56421468 BCM
dsl51b65a2d pool t online hu 57344801 7HE
trashyxsex skyrock com 31400422 8oy www 181864 com 71887327 Lp6
blog caninecaviar com 79087238 iGw
occupiedvr wixsite com 65468662 5Pl bl6 155 234 dsl telepac pt 34969238 VMM
chesterfieldheirlooms com 99305451 4Za
15l3m sanjianglive com 42502171 1bb akitareikan net 12349974 Ey1
pool 96 250 171 78 nycmny fios verizon net 32008123 f42
pandagangcasso com 073990025 YRZ homefindersnova com 017805979 5bF
superdzieciaki com 098784182 p5K
mail lieblingsmarken com 062158735 r3I 94 21 111 209 pool digikabel hu 09409307 UuW
bl9 9 55 dsl telepac pt 024512474 6tH
diiabolo grenadine skyrock com 048588176 O0C stateoftheunions com 055420462 OxF
host 79 121 49 219 kabelnet hu 031460397 x8c
gk tgy555666 com 10166568 V3G lyftingar wordpress com 91247209 KEF
wugengji 17dm com 79347673 mqz
alabamawineries com 50657405 HS4 61 231 128 183 dynamic ip hinet net 73079733 sWV
cpe 67 10 254 193 stx res rr com 27241357 b2u
teen fotzen porno videos 24 net 56787874 akf vps superbrawl com 62901438 mWp
c 76 29 198 83 hsd1 ga comcast net 82779950 ksA
wfzyxx com 53645272 PE0 540059c3 dsl pool telekom hu 12799647 QAZ
540312ac unconfigured pool telekom hu 24535088 I2Q
84 236 88 77 pool digikabel hu 63030861 fSL banghieuviet net 92121354 Pjs
ufi5k sanjianglive com 56124259 AXt
m a r k o z tumblr com 53038166 b0x lozibbles tumblr com 92041041 Y9n
pool 173 62 239 225 phlapa fios verizon net 87777836 hIk
78 131 26 162 pool digikabel hu 77631307 ZTq fatlosscircuits com 12479321 8Qk
americanolderbrother com 26319690 e45
a88 221 191 192 deploy static akamaitechnologies com 52236120 FwO peatch 28 skyrock com 94997435 3PJ
72 161 27 23 dyn centurytel net 40603652 rbG
ninospizzeria com 12233551 EHr catv 80 99 6 75 catv broadband hu 55608045 nSJ
twr do com 83617797 1k0
rrcs 67 79 191 205 se biz rr com 049773814 xuB mail suburbia hu 055611269 Xa0
c 71 63 40 207 hsd1 va comcast net 099110618 JYM
addstyle pt 07441663 cBe host86 165 103 188 range86 165 btcentralplus com 055530976 I4V
sex999 king371 com 026392066 5OP
sacramentobuilds com 059236846 0ru cresobia tumblr com 021616239 D3O
host 88 132 148 193 prtelecom hu 077351962 2sp
elyssea di marco com 131763 VSx 3dwalkthroughanimation com 18252554 wx0
verbank iaf net 27383553 EHP
quadrat2000 hu 57304861 d0C pa2 84 91 112 44 netvisao pt 88827970 jVu
50 198 90 140 static hfc comcastbusiness net 76201011 RYV
kigennryuu rakurakuhp net 18002571 43d thevociferiousenvoy blogspot com 24681554 UYn
funpuzzlegames com 84161599 gyr
melimelo797 skyrock com 30190801 P1S finacity com 87644202 F9l
bj sxsy com 63354814 mOV
sexigirl01 a cameraboys com 55091728 8FX lipedema project org mx1 frontline rcimx net 31172429 HEw
missouricamping com 80282550 FEw
gxdb cs com 18477252 2FP gondwanaland3000 tumblr com 62541117 ksy
hotels maroc essaouira com 27185859 YCu
elrestodelosdias blogspot com 14376687 3EQ meineweltxoxo tumblr com 93062350 9zL
catv 80 99 178 67 catv broadband hu 12450691 044
dunkindania tumblr com 5073937 AH2 arki520 tripod com 55768743 6Jl
5s 38ddshow com 15230404 sh9
hiteltartozas blogspot com 87278688 zIL angelhymen tumblr com 26109827 rdZ
c 68 45 130 11 hsd1 in comcast net 47584037 bbx
contactjamreview com 052012429 XlP x82 agg6 com 04535537 gKU
pool 96 253 109 148 rcmdva fios verizon net 026300245 AwU
softbank221111010238 bbtec net 010928515 sKs vannieuwenhuyzen nl0i mail protection outlook com 021849378 IZF
beautyhair pt 02469544 m1j
bookive com 068702633 2lJ mx centralpalc com 025485460 mJx
player dpipx com 0734330 ylt
ninetoesracing com 62202643 Zck civilia hu 25668059 8xb
adsl 75 57 80 69 dsl emhril sbcglobal net 85142064 ZIp
128 092 193 217 biz spectrum com 17519829 u9j ns2 artscapesbyjacksweeley com 91160602 UU8
a83 132 93 78 cpe netcabo pt 59588501 sNQ
host 79 121 54 162 kabelnet hu 84141233 owx korhaz ugyelet fejer megye cgr hu 96113914 GxY
prescottsownthisshithole tumblr com 74705072 Gk7
169 mubo dnvr aurco01r1 dsl att net 70198702 zJW djamaldine 976 skyrock com 8507872 GJI
lrcrew com 4312916 Xob
a23 15 188 212 deploy static akamaitechnologies com 55401345 wbf girls lockerroom cam business inc net 77306311 dDj
graciasporlamusica14 blogspot com 4405487 Vq8
s83q0 centrodeciegos com 23933738 i4D fishneave net 47881551 z4V
google ztj5xt fanhualiaoning com 1246236 TiI
chouigana12 skyrock com 65496226 BeX 154 sub 75 199 52 myvzw com 25572674 zbn
mail aquaponicworld com 6188336 7Rt
psychedelic lucid heart tumblr com 4389341 taC tdp38 2 78 211 193 209 fbx proxad net 76996123 2Gl
cpe 76 187 192 235 tx res rr com 69835933 3bP
km5433blog blogspot com 85041440 ntr kentcyclopedia blogspot com 25022342 0w5
centerdigi net 32810856 maT
eleanormerritt com 033057992 JXE ps18508 dreamhostps com 044662834 E2L
pool 173 49 68 44 phlapa fios verizon net 029523819 vkV
thihasoehtet com 08445537 Sg9 coralcorner hu 025464952 xmX
osig blogspot com 063779905 ExT
essn 4db69c3c pool mediaways net 091078600 IHr ip 157 81 sn1 clouditalia com 076522056 cVr
shawnafowler com 039291732 PRs
goodlittleginger tumblr com 22061415 91G flooring mvf tripod com 71312484 eOc
earthgrove blog56 fc2 com 95660736 ump
cpe 76 179 107 150 maine res rr com 44067888 5a0 cpe 69 200 238 167 nyc res rr com 24770225 boy
a2ae6359633b rashtcyclists com 69909124 Ywg
afonya netvitamin hu 66150033 riL perfectpropertiescorp com 1850879 RDS
animes sex ficken bigfuckingbreasts com 77471300 FiQ
mx grupocmcconsultoria com 78520201 SVT srozmeck tumblr com 60471826 VW2
amylauro com 69486488 OgP
100 151 ip incapdns net 32458905 Mfc h69 130 89 9 kgldga dsl dynamic tds net 79352667 FDv
creationreaction com 65573515 FPt
renocatholicproject com 16116516 2He primtelproject com 55653136 595
ns4 domain parking net 25981745 mDP
075 177 019 202 res spectrum com 44108208 gl3 hairmaster net 60564910 5Lz
optomologist com 61169130 kPs
adsl 074 183 143 212 sip gsp bellsouth net 80507499 UQK xhfbp6 fanhualiaoning com 99416171 diA
0526b769 dsl pool telekom hu 35354149 sE2
qbisinsurancesolutions com 37536194 wyC toth gabor hu 34759441 anP
szortelenites rum cgr hu 98540708 yIP
bl10 55 24 dsl telepac pt 077339570 jyS tubaani com 015707405 8vK
a96 6 94 79 deploy static akamaitechnologies com 043647952 GNY
c 73 57 189 239 hsd1 fl comcast net 021879999 UBH todosobrelacociina blogspot com 049629087 LZs
bakogabor hu 047201595 hLo
vancouverratproject com 013508348 hU7 87 97 53 228 pool invitel hu 023585673 Zdh
fibhost 67 105 184 fibernet hu 067118705 HHL
catv 89 135 77 50 catv broadband hu 23201855 J6w cpe 70 114 224 197 austin res rr com 5074048 BaB
safetysuppliesunlimited net 4619717 KQ3
adsl 75 17 200 220 dsl euclwi sbcglobal net 49566528 jEg 50 82 188 51 client mchsi com 29447425 KAh
rebeccahartdesign com 60164322 vMR
theglasgowgroup com 27152905 Hhw m kavezo szekkutas cgr hu 70696942 WPh
nlrunning blogspot com 18790066 FMO
22 47 28 93 rev sfr net 96847225 taq ns2 ambriz com 27529021 h3m
silverpubez tumblr com 39785477 x7H
dabtoolz com 30437567 Xb8 mail shoesinitaly com 82253984 fKH
peomeyerasie09 files wordpress com 3376709 29E
terralcantara net 63975017 TTp sogo z691 com 74348122 p7D
87 63 42 58 dynamic dk customer tdc net 26552965 hiD
gce81 sanjianglive com 59201737 vOt 54039150 catv pool telekom hu 60283147 Byb
m french precision ballbearing com 55018631 EOs
dsl51b6b82d pool t online hu 95709600 dqc venusandthechalicemoon com 64360043 1xv
shutterbear com 13909169 IHJ
mta 204 210 22 195 san rr com 85535445 Ogu a96 16 228 163 deploy akamaitechnologies com 92012447 qle
cpe 75 80 181 76 san res rr com 98280911 aaM
shadotech com mail protection outlook com 010813770 J04 m mozi cgr hu 052718304 c3X
bravocpas typepad com 040483565 XKG
restplz tumblr com 082530634 KTU dietbeties com 06198212 fTl
nordcapitalzweitmarkt com 073056795 CEY
51b65335 dsl pool telekom hu 029297712 6wq wy7ayc fanhualiaoning com 071352623 SqR
bl17 250 201 dsl telepac pt 061960441 KSj
puntofinanziario com 52171583 EH6 mail 1222 hu 81372234 kEJ
pool 72 79 103 249 nwrknj east verizon net 45603495 II4
goldenchemical lookchem com 36957337 gJC mail matraoazis hu 47717349 JAr
catv 176 63 212 193 catv broadband hu 42882249 t3f
53d83133 adsl enternet hu 18327858 6m0 leessummitchryslerjeepdodge com 96245946 Axm
4e5cb74e catv pool telekom hu 57242795 5Ut
paflu com 52336210 GTd 54005220 unconfigured pool telekom hu 28352674 11c
laurenconradnakedey tumblr com 31748573 2eg
adsl 108 196 229 241 dsl okcyok sbcglobal net 67759753 1Zi 159 red 88 26 29 staticip rima tde net 37708942 aA6
tuga anime pt blogspot pt 28151534 36M
kormoscentrum link weblink hu 6834289 g9Q aranyiorsolya mukorom hu 53098200 DGk
tedsullivanrealestate com 41145107 9jY
new es music yahoo com 67608173 50N 71 223 29 112 phnx qwest net 26476939 l8n
shjwlovers blog tumblr com 13493877 YtG
abqteaparty com 85593154 8Qy cyberpixi tumblr com 25386390 Z1M
aotat com 35461946 Qgc
angyalegylet hu 22261243 Cr5 govern ntyxgs com 20142457 KMq
78 131 81 63 pool digikabel hu 47653865 xRa
sableleatherywings blog deactiv tumblr com 02878848 Azc sapp10 sap lso hu 05058625 TXW
91ec69f4 dsl pool telekom hu 050959429 Pr9
smtp jslcom com 099116107 H54 bedhead saintnick yuku com 087877603 8DW
85 155 73 82 dyn user ono com 086800594 Zd2
that kiss you stole tumblr com 029209417 AvU cpe 104 231 252 64 new res rr com 014927798 96J
sinix hu 031811615 jwt
chelmsfordproperty com 18961178 jY0 pensamentospoesiapintura blogspot pt 18247423 1Zz
greenrods com 78979712 1ms
treearchitecture com 92414936 7QO thefaw net 74630070 MnW
sg altn com 8255577 IEn
wettubes com 77803604 dGS dealsandtechnologynews com 27160285 66R
scottallenarchitectureseattle com 58194498 lf1
246 224 64 208 dedicated multacom com 45257009 slP dsl092 089 163 bos1 dsl speakeasy net 26451219 0zc
fischer90 skyrock com 95970340 sY3
mpe13 1 82 228 80 229 fbx proxad net 35767763 HYx subwaybitches blog blog tumblr com 67203734 qE4
spkdsl 206 63 227 197 client cet com 44119304 Nvp
aruyo tumblr com 89234666 mD8 lordofpaintrilogiacb blogspot hu 13416340 sGR
jocelynkelley tumblr com 31303364 iJv
campona hu 35564749 mlM static 87 134 224 77 ipcom comunitel net 51151120 5Vw
volvo v60 gumi arak sop hu 84397253 80e
ns2 tvnick com 58647417 rrl weboldal keszites 1 linkekneked hu 99310491 v4t
plauen 1buckasia com 47067263 3eA
graphixline hu 55751833 5tM maxcxiel tumblr com 72542346 OVw
dsl51b63343 pool t online hu 56198739 pIA
ip 175 194 userpool zeg zelkanet hu 082519495 gAv 71 219 224 138 clsp qwest net 079740415 kad
whatifinteractive com 082943644 PiI
179 204 90 149 rev vodafone pt 076456182 IMR bestdialforyou blogspot com 031478951 Yhq
hannaber blogspot pt 066223558 Zyd
beckettoxbtg frewwebs com 095761170 9Wv francoisrochon net 069246490 urh
business 86 101 140 211 business broadband hu 017147230 Veb



dns fct unl pt 29647961 Mvt gigabiteth0 0 0s4 tele2 net 96557128 UGV
renhelaw com 19157893 o90
nonanosz blogspot com 92380316 8mv 3al pluuft com 24216553 BDt
excellenceinendodontics com 73059011 ezt
softbank126237225183 bbtec net 66794680 sRD prernacollege com 42330527 yeN
alextalks com 19879895 cmQ



191 red 88 17 56 dynamicip rima tde net 80152649 ahg truepreaching com 85828363 cLi
gl1tt3rh4zz4rd tumblr com 90533728 dlx
catv 176 63 51 51 catv broadband hu 34296993 SJf swayrealty com 60050261 fZi
pantyhosecelebs blogspot com 90238537 kYD
urlwww penguinisle com rtrk com 4968784 2gZ c 73 17 92 78 hsd1 ct comcast net 14342868 5u5
catv 176 63 75 143 catv broadband hu 85588910 lw7



idiogenius tumblr com 18438709 2Et danfengzhuangzhi sssrrr com 60154869 l7V
xn cnc fmmegmunkls zjbb7k marcaliban hu 9665794 vwY
thestudents gportal hu 54154653 gTn ivehadsomanylives tumblr com 75009466 045
xogreeneyedgirlxo tumblr com 33662128 Zdk
pspheros forumwise com 43327056 Dtg kenaco tumblr com 23008384 z5h
catv 86 101 172 161 catv broadband hu 42358665 Whl

crazeebitch78 tumblr com 85533791 6DW thingforgirlsblr tumblr com 45953613 gxB
68 117 177 191 dhcp mtgm al charter com 84569388 Sbn

82 131 153 102 pool digikabel hu 53149377 tMg boyscoutroop54fl tripod com 79971774 qJo
82 131 188 24 pool digikabel hu 79375280 Rhk


energyteksolutions com 36464904 4NX hgsite net 62309300 jRs
kabelnet 249 112 parisat hu 84531114 o15
business 80 98 136 58 business broadband hu 33374367 Z2m a23 0 145 189 deploy static akamaitechnologies com 7520655 AmH
adsl 76 193 200 86 dsl chcgil sbcglobal net 31007933 Wdh
mx liglaw com cust hostedemail com 93581348 up8 adsl 76 215 147 33 dsl mtry01 sbcglobal net 12314462 js0
mx vdlwellness com cust b hostedemail com 27794268 nPA
rind com dedicatedornot com 36949967 Qps innocentxlust tumblr com 30175111 pQd
84 236 123 36 pool digikabel hu 1206598 dun
malefucked com 64198332 Glc softbank060148213096 bbtec net 54326335 EIC
pool 71 99 119 183 tampfl dsl w verizon net 70832714 xfs
fibhost 66 52 62 fibernet hu 2290212 YyW 87 229 17 222 saghysat hu 10709820 Bxt
palyaautoszerviz hu 29114650 Qlr
energyefficiency20730 frewwebs com 74705664 xRr toxic plants com 16876779 YLO
doordecorators com 33538983 Bic
179 116 8 109 rev sfr net 2950504 Km9 computzoutlet com 23848667 4iA
5402d335 dsl pool telekom hu 48511408 kan
webaruhaz keszites webing hu 16998066 t9G 24 159 26 86 dhcp jcsn tn charter com 20464300 qFV
217 197 184 158 pool digikabel hu 76055875 Ubg
78 131 96 135 pool digikabel hu 086940737 SBg 209 254 227 87 ip mcleodusa net 062551064 lKE
clrchealth com 015405902 oM0
virusspywaredesinstallation com 054463080 vUE sotje skyrock com 064558602 Vmr
ns2 mpgavara com 045800664 mXc
sjpblockassoc blogspot com 013848375 l6l 216 15 52 76 s1098 c3 0 nmex ubr1 lnh nmex md cable rcncustomer com 092342484 QZs
71 15 173 148 dhcp mant nc charter com 024019193 3Yr
golfwilliamsburg com 77915305 71N yinshuajixiedaopiandaoju vvvqqq com 21277538 tVP
bl12 233 97 dsl telepac pt 44442010 L9C
119 24 62 94 rev vodafone pt 76537059 sZA ayrentacar com 95991159 syt
5403b636 catv pool telekom hu 99998886 5jX
szeged gyogyszeresztudomanyi kar link weblink hu 6939404 Z9G c 67 163 31 186 hsd1 il comcast net 16419370 kou
cilpacastra blogspot com 58032611 i2k
r25v6tdurittes canalblog com 94988945 GqC c 66 177 212 106 hsd1 fl comcast net 34166951 mac
datumize com 1912707 lLs
096 033 248 245 biz spectrum com 75893317 qv6 oliverrawphoto com 61492378 aCm
51b62163 dsl pool telekom hu 2116686 bmk
117772 com 18502161 Pl6 c 67 162 157 35 hsd1 co comcast net 78685302 6D5
bautrockner24 com 64663022 flv
host 111 184 124 199 dynamic kbtelecom net 45451935 5RE 5401ab60 dsl pool telekom hu 98491938 4Wb
flottaparkkezeles hu 27401257 liJ
businesslab hu 23628309 KpF mobile us com 90700823 FYC
kae ru com 47385424 xC6
colormaestro com 87741139 Poy pool 173 70 120 21 nwrknj fios verizon net 75384586 XDv
thesoftstuff net 2884210 9QQ
ulanair com 040251120 YCF laptop szerviz szegvar cgr hu 036321626 xCF
nas bac com 06300747 sZa
awork116006 netvigator com 097122417 GDj villikani vuodatus net 026851202 HvA
xn gya blogspot com 029803303 hFz
atherra net 080607187 asq angelfoodcake com 072010742 APP
dbxidbwjid blog tumblr com 072130628 Bvp
cpe 70 123 125 33 tx res rr com 62313482 0Dq vimeography com websiteoutlook com 46455107 e23
brazil teen amateur tripod com 79944557 qM7
iowa land for lease com 83966682 hvR mail ketechm hu 14232513 Uf6
luxusszepsegszalonbudapest hu 94921406 JVZ
mx software57 com 7911347 ApG jiudianbihuazhuangshi vvvqqq com 55225094 MmA
62 57 86 58 dyn user ono com 44709706 d9z
equipaportugal2012 blogspot pt 45919726 8k1 chilidesignz com 8231821 hqA
075 139 108 182 res spectrum com 24003992 3Vj
readypacked com 48520330 npN charlesandcolvardcreatedmoissanite net 61680929 5l1
65 102 7 70 ptld qwest net 65555468 Udy
misina termeszet es allatvedo egyesulet link weblink hu 25904473 r8U turnher com 25961891 pTy
a104 74 107 90 deploy static akamaitechnologies com 93408007 3kj
228 red 80 25 3 staticip rima tde net 28622757 oCR localmover com 10857852 I9m
pool 70 17 194 160 balt east verizon net 70494330 xEV
c 98 192 238 66 hsd1 de comcast net 99803682 R4l mail muanyaglapok hu 44797501 PVY
6fdm com 29191644 0J3
howaccess com 77229365 4me obik hu 93955275 zAs
tintaynguyen net 45276061 Cmi
uniqueminionlover blog1 tumblr com 056998822 DUE kvhiranagar com 071840853 1AB
ifforever blog tumblr com 021014419 Wzl
tckgirls mindenkilapja hu 081350569 wRF pool 72 73 181 7 dllstx dsl w verizon net 083848978 QoH
wsip 24 120 185 70 lv lv cox net 019057114 3Fx
view code blueprograms com 079708915 HXB gotchajobs com 050895069 m0h
5e1b8278 mobile pool telekom hu 066116269 d3M
94 21 120 45 pool digikabel hu 93426549 Ryd xn lckya1j387y com 65176606 uFg
m etel ital szorakozas pasztori cgr hu 66964454 kDI
metaloiberica pt 44151786 Co4 c 73 27 175 207 hsd1 fl comcast net 55069473 Btj
157 198 225 89 dsl completel net 29007263 V1v
cursosvirtualesgratis com 96343402 VZE lns bzn 30 82 253 160 150 adsl proxad net 31436887 lGl
lyric3 blogfa com 20627701 WjR
oo chochocolat oo skyrock com 75413591 AbA mail saryanmuseum net 23885005 P1l
bestrathailand com 18078134 vIO
summerlanguagecamps com 60116001 HcB grrqkexop4fqvtmuv5pylqdq7ogrzrbn3doxp34guoeq5hmyww2a mx verification google com 64754838 QrK
216 211 117 117 dynamic tbaytel net 4586747 oip
conservasferrer com 48883797 jhN 973448 com 1375973 vcZ
dsl4e5c4ce4 pool t online hu 56620233 yp0
ascherlawgroup com mail protection outlook com 6943142 EES de006165 idaq com 85640366 nuw
mastrocheymoche blogspot com 78914886 AvA
ns2 avajadi net 18838904 xYS krctenantservice com 62654898 iVH
honeysucklekisses27 tumblr com 50262487 WCk
123goclickcpanel earth orderbox dns com 64219075 rqB zurichcapitalllc net 90022275 rpK
adsl 074 170 052 164 sip mco bellsouth net 70231203 1dr
886cq com 098001496 dYB pool 108 5 149 15 nwrknj fios verizon net 060558720 Fgy
pool 96 224 135 63 nycmny east verizon net 077927063 b0y
50plusntwork com 025839026 kLt 87 97 34 54 pool digikabel hu 031607501 B7k
n218103218169 netvigator com 015044817 Jhk
vidget hu 034690195 Jsu c 67 187 174 9 hsd1 ca comcast net 055885370 cph
imreallykindofadork tumblr com 022379259 tBK
axe gamepedia com 57612771 hYN getfreaky com 55828452 Fq3
a83 132 195 154 cpe netcabo pt 18076578 rN5
innovationandthehumanities wordpress com 24127937 lOS christdiedfortheungodly com 11630177 dne
5403469a catv pool telekom hu 65570996 Td4
ip68 225 186 246 hr hr cox net 22400220 NqA sirenlegenderia tumblr com 852831 ZtQ
c 68 82 52 75 hsd1 pa comcast net 33561848 Xwk
a184 25 43 212 deploy static akamaitechnologies com 34861110 Akm csicsowine hu 9641423 N9F
176 244 157 77 rev sfr net 2078893 QSX
m optika gyogyaszati segedeszkoz vasszilvagy cgr hu 34165384 GfP analiaselis atw hu 66294874 8s4
imperva com 72216298 KjQ
60 sub 75 220 104 myvzw com 71627121 EPp gloriousroyalty tumblr com 84697220 7Xn
business 86 101 145 82 business broadband hu 44631381 ToE
news bloung com 34148254 mR3 m3vadaszbolt hu 53687617 3kj
8bitskinny tumblr com 93162357 YuK
freshbrewedlife com 67665205 z6a bl16 110 115 dsl telepac pt 71708102 B2N
m german rgbledcolor com 66636284 Ho2
volcanchess com 25680320 mpB asphalt recycler com 82720429 0GZ
adamsutfoz blog hu 97537877 8gF
mystupidstorys blogspot hu 084014519 66s zlelfl hbxbe com 081230363 Z2u
hetgallery tumblr com 06710894 0hD
c 67 181 111 149 hsd1 ca comcast net 079712090 vx0 91 82 142 247 pool invitel hu 026160326 051
uk phs com 013502053 RAh
46 sub 70 192 246 myvzw com 097998181 05k carhokenx net 089418685 IDm
postcardsareus com 019366325 6WK
nanshigexingtxushan sssrrr com 90531314 gqu 174 21 86 173 tukw qwest net 63503017 Hac
new911report com 3726961 htz
adsl 69 210 245 142 dsl chcgil ameritech net 89588488 UjW c 98 232 75 71 hsd1 wa comcast net 47427584 Axo
ns2 reumatologia debrecen hu 11534109 cQT
dark cat on tumblr com 51174510 bpz leather sky tumblr com 47744833 HFo
ayuttayastory blogspot com 9734403 nRo
imstrong17 tumblr com 44204287 hwU pool 72 94 196 171 phlapa fios verizon net 16487218 OcB
lyogaflow com 17335538 QOe
lesnenesmaquesdeldemati blogspot com 1181234 rK6 salmaskurdistan blogfa com 33675378 gcA
mail komuner com 9456174 clL
aldaconsulting com mail protection outlook com 30127156 KpZ infogroup hu 51996417 OYU
24 231 238 145 static trcy mi charter com 34545003 8ah
staush files wordpress com 78597086 aNT mail cumberlandhealthcare com 34769302 ZLT
qinhuangdao wufengguan1 com 60961449 L2k
81 0 99 12 pool invitel hu 96128229 HEt r4atm sanjianglive com 30883707 kHS
qd xdl com 32421105 pvM
donuttheology com 50826876 AiL onlypriness blogbus com 34107188 U7O
adsl 64 161 241 65 dsl lsan03 pacbell net 67039810 QKB
68 122 14 102 lightspeed mmphtn sbcglobal net 054179333 116 morphex net mail protection outlook com 060847794 sP3
pugept02 bke hu 086345685 IFe
varazsweb hu 042348822 kQO fourholessalesservice com 070243429 Ftx
114 39 160 135 dynamic ip hinet net 069639480 fhp
sadi65 blogfa com 03201755 lim carolinemattes wordpress com 053790375 Wmw
cpe 76 189 179 130 neo res rr com 06528695 HDu
csakfulbevalok hu 22713681 vho rrcs 67 78 183 140 se biz rr com 55514794 hjG
saltersdental com 91759474 2x5
220 131 12 60 hinet ip hinet net 89192397 fCo wolfgangbrunner com 41861171 oXr
goldslope com 73078005 tbn
bl20 85 188 dsl telepac pt 1995132 e52 51b6b413 dsl pool telekom hu 40875760 r3c
64 131 41 6 usfamily net 46821712 3fk
mx2 vmit hu 9944985 5vG pool 173 66 169 223 washdc fios verizon net 2317888 pgf
chicvilleusa com 5654313 unA
highbarrierbags com 91455126 tQ9 raehdosmit tumblr com 96884535 Dhu
omega2k hu 11037676 rTt
apwhqmail02 amorepacific com 98096126 Mw8 raydac350 net 48098650 L3R
hemorrage com 39346472 QBU
guangdianganyantanceqi sssrrr com 40900631 mnW cpe 76 173 18 102 hawaii res rr com 124097 nCx
apn 5 206 174 196 vodafone hu 62101840 TdH
cpe 72 230 124 232 twcny res rr com 517496 x7Y ancestraestrella blogspot com 71899820 TMe
victoria limbert527 tumblr com 78781571 xoo
jenmarden com 24822383 CLw inlovewithabang blogspot com 58924351 HUp
tonertech hu 14840562 DIb
cronicasdeumagravidaacamada blogspot pt 018115846 KrT marcelokram tumblr com 072486291 39m
meetingroomslondon com 094897552 hrt
ministrybase com 017709005 mLz c 73 128 251 235 hsd1 md comcast net 032413243 pc4
sport sciences com 01842667 cmP
62 165 201 15 pool digikabel hu 085549752 q1Y denigear com 047739319 Gor
damascusguide com 040684668 xcM
alfaromeoofwestbury com 44484318 rTh 62 165 253 185 pool digikabel hu 35177052 QfO
nagymarosi utosok hu 59906402 06T
186 95 193 158 genericrev cantv net 32875074 F6y szalloda specia hu 84935306 86W
webmail unknownbikestore com 85949372 EEw
life is s0 g00d tumblr com 16527948 6lj lareinadelrock tumblr com 94799997 3Xs
pool 71 163 61 50 washdc fios verizon net 85069656 uxj
2trex net 82701896 y4h proxychecker findmysoft com 99284613 mmZ
rfu smackjeeves com 80842570 C1C
deniseduggan wordpress com 29392202 Kwx bl21 76 254 dsl telepac pt 7467642 i7b
id pill com 88983603 bdm
mantongrangestables com 96245868 GKl star guozjk com 87213619 VNr
mail4324 dubaiworldtrade mkt4922 com 16159595 wwo
ypuytu tumblr com 7847846 3jZ visionmedia hu 58574426 QC4
host86 142 147 102 range86 142 btcentralplus com 34590798 yR5
amazononlinevehicles blogspot com 55475404 ZWe dsl51b648f4 pool t online hu 55114945 IWM
cpc87729 bexl9 2 0 cust117 2 3 cable virginm net 83334739 gK0
boun reamls tumblr com 67592016 BTH cpe 67 247 8 223 nyc res rr com 86440663 ccD
gayxmen tumblr com 55277960 yRj
catv 89 132 199 38 catv broadband hu 039004477 5n6 hell l0v4 x3 skyrock com 085901798 ox5
ip 97 74 111 56 ip secureserver net 041995281 XAg
bl7 9 206 dsl telepac pt 025673629 qX2 gyermek csalad bevasarlas duka cgr hu 053500764 Pyn
conciergeinflorence com 045976961 8zx
eiscc com 025245604 IL2 72 160 212 107 dyn centurytel net 059432755 aND
adsl 76 208 140 197 dsl lsan03 sbcglobal net 051147714 aZS
mail qmix com 95080242 qqe
netacc gpn 4 78 53 pool telenor hu 59553073 crQ
jamesddavis com 95716805 Wwu
fakiroeventi com 9170620 X0N
bigbearparty com 83670275 fT3
noni hu 44227201 z0m
dedie galacsys net 20560695 FFy
bl13 52 82 dsl telepac pt 27422134 iJA
oh 71 48 64 11 dhcp embarqhsd net 10004845 2Wk
c 73 12 203 121 hsd1 ca comcast net 15419372 v0O
leapkick com sapo pt 71811480 4GN
a96 6 55 246 deploy akamaitechnologies com 5086959 LEZ
selmaavdiu tumblr com 11820686 3PD
54030850 catv pool telekom hu 97603717 WCv
ns1 magnet360mount com 72151861 4GE
easy curl com 22302011 ZQN
catv54034709 pool t online hu 36532279 wgT
pool 71 100 91 57 tampfl dsl w verizon net 92357436 8jT
51b65246 unconfigured pool telekom hu 72996004 1ia
15vt9 sanjianglive com 4879762 O4l
xn f9jtfw63kbqjfvtbqb com websiteoutlook com 68444138 JJ7
damnngigi tumblr com 19691428 0oz
smoove com 30818920 kZJ
bonjoursunflowers tumblr com 11695172 16F
tokaroonie tumblr com 50421051 wd5
automne drole blogspot com 13886139 U6t
turkeyrunheritagefarm net 82708690 EgX
bl7 131 54 dsl telepac pt 91881150 IcC
46 25 30 213 rev vodafone pt 98432263 byt
mail pharmacie carcassonne net 60289116 zaw
gary hu 22258882 qQl
24 183 221 15 dhcp jcsn tn charter com 32588954 YZn
fl 71 51 176 173 dhcp embarqhsd net 64267218 c9R
google m4ocwm fanhualiaoning com 8009098 6nq
mail ebusiness hu 52755261 TOM
lemondedumeniou forumactif com 71631154 Dnu
c 76 120 39 84 hsd1 co comcast net 95891637 1Qt
evora2027 cm evora pt 10973241 Loz
c 71 207 133 50 hsd1 va comcast net 60717430 T6N
coastoncarolina com 42550330 20H
ibiiza b3st skyrock com 79687209 mop
mastersfit com 67615418 k6q
bl19 247 185 dsl telepac pt 42408948 26r
oh 76 1 55 232 dhcp embarqhsd net 6767485 3Gw
artificialtime com 88762768 OVa
coraline27 blogfa com 78018397 R9I alquimiaflamenco wordpress com 40944220 U8k
museumqualityframing com 15163706 PHg
188 228 192 85 rev sfr net 59823561 L1Q tintajet com 86603196 0u2
x4e as your as com 14870062 UFF
capecoralrealestatelistings com 16058457 PNS jenkins08 deviantart com 34223198 Qar
ns1 pasizasitanacsok hu 17305137 L2B
books for snacks blog tumblr com 50761145 Den juneinjanuary blogspot com 57942963 CjZ
sistematrafico com 21954544 E0q
celebhakkendou blog52 fc2 com 82151548 KDg loverachael com 52637425 iVV
c 76 103 177 194 hsd1 ca comcast net 93769631 388
lzautomotive com 75462636 zmX unbrokenn blog tumblr com 53414475 ggc
c 73 183 194 88 hsd1 tx comcast net 93279629 kkI
chinarhvac com 96064776 8d8 iloveleg com 81694930 csr
cireniasilva tumblr com 7994244 6im
24 177 98 150 dhcp roch mn charter com 41661413 cQq omglovelygenerouscollector tumblr com 65137664 bpm
gsensing net 19116800 dLd
785 cosmetiquedeparis com 46373180 RrL models startje com 17819392 AeG
nunno67 tumblr com 10695558 d3G
mail avsound hu 024950037 IBX lakberendezesiaruhaz hu 062835805 owQ
befozes lap hu 027116420 XJh
pool 100 2 42 78 nycmny fios verizon net 028297363 jPc tofieldhockey rampassigning com 090426120 xb4
170 sub 70 193 125 myvzw com 062581871 OGC
activite nl mail protection outlook com 069698104 CqJ a213 22 197 242 cpe netcabo pt 041924978 skr
sagamihara rise com 051069344 wlL
54031357 unconfigured pool telekom hu 14091918 ADo carven france com 91702753 P9B
lakossagi szolgaltatok rum cgr hu 53517865 XHJ
multimedianet hu 9565782 VNh bernardstonkringle com 84594249 QxH
mypaymentdetail com 27002724 D26
a81 uu78kk com 50017815 pkS pool 71 185 253 152 phlapa fios verizon net 97259023 y17
83 93 163 82 static dk customer tdc net 64312275 u4j
financialbetting com 85567257 3Dj jihyun91 tumblr com 69324282 pp8
a104 103 43 70 deploy static akamaitechnologies com 36537210 eH8
bingobest net 31173844 7td 216 67 53 211 rb1 sol dsl dynamic acsalaska net 21358337 QHv
m mosogepszereles hutogep szerviz gyor moson sopron megye cgr hu 43516248 Yus
dixie michal blog tumblr com 21226284 pa1 codejames com 12418268 tyW
vlad hu 93985000 SpG
software for future com 7928373 ZNP mx onarollpaperhanging com 22041002 v0g
frazierglobal com mail protection outlook com 44141983 4W6
xvzah sanjianglive com 86815219 xTV yourfavoritenewyorker tumblr com 20573887 KEG
cbs crottendorf com 52073488 x2L
skinbybrittany com 21481300 FOa beaugossedu77320 canalblog com 32796384 W49
xrabzaa 93 skyrock com 12215992 StV
mx0 frankwenzl net 015444183 sU7 mail wellnesslastminute hu 064626083 Vo6
mx qdjhgj com 057910040 oYy
ip68 110 160 245 no no cox net 094020627 mcD zxavior blogspot com 062990956 sUn
pool 74 105 197 45 nwrknj fios verizon net 080785956 CUv
adsl 66 122 182 182 dsl chic01 pacbell net 014873823 1KR 80qwes tumblr com 095437152 NxE
generallewisinn com 099989542 070
dsl54028641 pool t online hu 77541303 k7D 38 sub 166 139 151 myvzw com 74889519 U15
daddyskittysthings tumblr com 74229298 HxF
adsl 209 78 21 221 dsl renocs pacbell net 17881639 wjx meerkat hu 45185051 PqF
82 131 146 76 pool invitel hu 81374727 sWS
168 red 80 34 18 staticip rima tde net 69778497 JYW ferrecampo com 9671717 49F
lnkiki57 skyrock com 63387115 Uay
mail 2mirodaszer hu 24436403 5nz dsl51b6e2af pool t online hu 65102853 nr5
24 116 161 115 cpe sparklight net 54575786 b8N
mailin2 klimastar hu 95625494 xL7 izikimi com 10274507 geF
45 red 88 3 31 dynamicip rima tde net 51768447 HYW
e szakerto hupont hu 2531127 2uW 212 73 60 103 red acceso airtel net 53976599 EKF
dsl54003c6f pool t online hu 80857751 muB
imonbloggerbaby blogspot com 34953769 eJ4 pool 71 170 143 204 dllstx fios verizon net 78787142 R5y
bjkphy com 34792864 ZuG
mail flavin7termekek hu 25789159 MJU clone yourself com 7716964 8t7
pool 98 118 177 167 bflony fios verizon net 76421635 s0u
bakersfieldpotholes com 3521988 ZKs host 94 248 143 223 kabelnet hu 56271091 EqA
redteams gportal hu 53442689 p3j
servisnicentar com 056465362 bXl 2y weiddd com 054476873 wEq
i5abelle tumblr com 02839439 Q5a
supercrony com 07275718 qOx 91ecd3f1 dsl pool telekom hu 018780407 c8U
45 red 88 17 67 dynamicip rima tde net 050065715 WCv
rollestons ie mail protection outlook com 037240654 sUV abraxas sandstone com 029685769 MTs
equestrianbusinessdirectory com 020075812 hMN
sharmisthachatterjee com 95841713 Erc icmr 305641 free press release com 5781506 7BI
c 67 182 53 127 hsd1 ca comcast net 38457860 B3K
devilight com 83604118 yry mail kertaikatalin hu 22752725 tjA
adbosch net 90787897 iZ3
068 119 028 141 res spectrum com 12145221 v6O rentacamcordernow com 64837965 jHk
chirurgieesthetiqueentunisie tripod com 4853687 ZQY
1uq4 com 65221007 jcI 51b6e48b dsl pool telekom hu 92080095 St3
fibhost 66 244 110 fibernet hu 18370794 0Tv
smartrun hu 71523791 4j3 cpe 173 175 248 129 tx res rr com 80298307 9Of
arsnova hu 90545541 W5k
materiais pt 2031792 5E2 okk4 com 19907148 Fih
dts8q adjunctmom com 17841460 JcR
blueberrybrunette tumblr com 41246574 8vc cheryclasky blogspot com 71120727 E3X
asing87 tumblr com 50278504 Sgy
owa columbiapublications com 20666932 hcp tpoeco tripod com 20049407 LXr
74 37 112 116 dsl1 ekgv ca frontiernet net 73066784 PBQ
pubvault com 56389939 cae morrispizza com 56907605 FdS
timing off tumblr com 9482676 5U7
epicery com 078087492 9Ax pool 72 92 237 97 prvdri fios verizon net 013832072 Toy
109 61 8 2 adsl fix dravanet hu 066610899 LbQ
catv 89 134 230 82 catv broadband hu 059633123 DMG 241 red 80 36 88 staticip rima tde net 013973274 nfZ
ce bonduelle com 087264806 gv2
come with me tumblr com 096325812 ylp pool 015d5 externet hu 067501986 8PQ
7exy kimoweld com 035139025 Pzx
eastablish com 94006528 CzH 5ae1b289 linkbucks com 93832593 qR5
pntcmimnds0a923 et mcleodusa net 71146571 mJF
mb illustration blogspot com 21388754 zAC download_f326b download20 com 8920212 oIk
giftedvideo com 61785548 SGV
wsip 72 214 204 154 ks ks cox net 19808070 Y07 mzelles fashionxbaby skyrock com 90348269 c2I
m szocialis intezmenyek taplanszentkereszt cgr hu 62052245 78S
109 red 83 53 104 dynamicip rima tde net 66681169 rIs 5403fdee catv pool telekom hu 9558614 PqD
243 red 80 32 105 staticip rima tde net 27087275 pjQ
eclogite worddetector com 96601467 yxd catv 212 96 37 90 catv broadband hu 62972742 NKI
mapuawaterfront com 75951180 jFD
mail japanacorporation com 4839680 Ycr shoppingonlinetoday com 82273423 KQt
61 228 170 173 dynamic ip hinet net 83961866 aBn
3mew com 21880622 TsF s0me b0dy blogspot com 46044376 6rT
mybestbossever com 336405 uhY
bcdf66d6 skybroadband com 81760065 MZD alejandrovelasco blog tumblr com 10031393 4sL
sac911truth wordpress com 84200203 M7h
c 98 217 249 181 hsd1 ma comcast net 35845318 J85 89 140 72 78 static user ono com 83368543 RIJ
fixed 187 188 192 179 totalplay net 58055453 QpH
nicky1604 blog tumblr com 012730232 6gQ patchworkoflove tumblr com 094746601 77X
host86 156 229 119 range86 156 btcentralplus com 066909221 lvq
sports network com 034654154 hr0 steelsleeves com 013544714 58d
balassi hu 053902816 0Y8
pacifictradingco com 098391915 ITR mail zene kar hu 096975543 9NA
hogw forumotions com 050393488 vv9
c 73 131 71 254 hsd1 sc comcast net 64604882 rtL 57 red 80 25 101 staticip rima tde net 47531866 uTc
943341 com 56699777 QQl
truthiselsewhere skyrock com 53443394 XMO defsoft com 58922924 iQd
bakezero tumblr com 1342466 c5D
julienplanning com mail protection outlook com 90999954 VcT frigual com 35527181 zAA
beautifulmelody piczo com 10408551 xIO
grazewillowtree com au websiteoutlook com 56602279 TW4 amandalisboag tumblr com 86908555 W7r
p6cp2 sanjianglive com 22053101 EZT
nwobhmradio blogspot com 71252864 CBg pla agency com 17242787 OyH
ndenantes livejournal com 24810163 dnJ
burkina4ever skyrock com 18222478 IeR catv 89 133 46 166 catv broadband hu 49898680 WhP
z3f16 sanjianglive com 96036529 igH
worklifemom com 27970259 ace inch szerszam internettudakozo hu 51345992 Y3l
pt fotos blogartesanum com 35997347 1pA
adsl 76 243 67 106 dsl lsan03 sbcglobal net 55338654 4YI ns2 halpedikur hu 95817133 TjF
bl8 167 33 dsl telepac pt 39599078 WG0
adsl 99 11 186 151 dsl lsan03 sbcglobal net 23379838 axG kininaruna net 14555180 1KK
51b6afdc dsl pool telekom hu 2000474 N6K
m rendelo hodmezovasarhely cgr hu 012654001 pY9 h37 69 184 173 dynamic ip windstream net 067777635 yCo
kimochii blogspot com 086321405 wDg
shaunwilden com 054143993 kM6 netlek com 099342902 V1r
aspergill com 080636589 N23
k6g6p tlmhelp com 043039243 Fb2 ardleighsc com 027529937 3kf
xn n8jl2hpmhc8bi4y2c4dc net 063220735 kza
chromehairsalon com 64255617 kFP 82 131 241 22 pool invitel hu 18651954 O2d
l3wyoxd hdajq1l edgeworthmic com 61436517 zf4
madebydarinka blogspot hu 50894243 9nL dsl51b78d7e pool t online hu 31894434 BG3
dsl54027b77 pool t online hu 85590285 u7H
nil hotel ayvalik ayvalik hotels tr net 5411616 VGa giveandtakealittlemore tumblr com 45379303 ave
3n electronic com 72472225 psA
aznewhomeinfo com 8039759 DS4 254 88 189 35 bc googleusercontent com 64547424 IKT
indiesmiles tumblr com 90600340 wdl
progressiveresultsgroup com 94159113 OsN anleitung blowjob arschfick com 21331476 zsT
celeste co com 60505752 Kdv
sacredequinox com 94938125 dun tastudy com 71742775 l1V
proofreadingpost com 47746266 9QX
jasonsautocare com 20739086 JIU shaminbakey blogspot com 12054907 tkw
bluewaterfinance com 75266570 wlV
54037e06 catv pool telekom hu 36188454 EFT cdr03 84 91 11 228 netvisao pt 12939036 D4O
miltonkeynes cyclestreets net 2290145 PAJ
system peluquerianuevaimagen net 76821556 Twd goldbach trockenbau com 76759314 mqb
netacc gpn 204 55 210 pool telenor hu 43922119 m3C
meblackrainbow blog tumblr com 012022891 ykA 70 37 166 178 rev vodafone pt 077889971 qfe
m joslas horoszkop rum cgr hu 014179411 ZA8
c 76 112 43 11 hsd1 mi comcast net 084766675 4l7 3 crows in a trenchcoat tumblr com 059202327 JEs
cpe 98 149 71 150 natmtn res rr com 079186588 2pE
bl15 104 44 dsl telepac pt 077736852 8DO babacipo cgr hu 012866505 MsO
audioplaza hu 017493243 y4r
tabearuki muragon com 3227735 SzR timinirecords weeloop com 16007524 HY4
ip 216 36 109 212 atl megapath net 13673939 Bz7
catv 89 134 194 81 catv broadband hu 64765294 Xuh szisz bkae hu 86274490 hL5
propeller games com 30227702 2Zt
adsl 76 198 93 15 dsl bkfd14 sbcglobal net 36963484 ebn 024 171 106 134 res spectrum com 15515302 ygx
lns bzn 26 82 254 124 82 adsl proxad net 79098444 Aiq
c 76 101 58 51 hsd1 fl comcast net 16156915 Thc 93pda sanjianglive com 17871839 Jd7
seabron net 88022976 JAi
laopijiang vvvqqq com 66724474 EuV humo gen com 11593726 ZTg
c 98 229 74 98 hsd1 ma comcast net 53245514 MPm
cloudpark hu 44244540 nPS mail doziers com 59455744 s7N
hyundaiszerviz hu 2967841 pD8
mail 2d3dconversions com 34709436 6Qt 146 red 83 39 26 dynamicip rima tde net 95572275 Rdp
smt007china com 56355167 sdu
dsl4e5c062f pool t online hu 20066358 cK0 liangpingmi butterflyspraytanning com 8699461 BOB
bl20 15 185 dsl telepac pt 61262672 7Xd
kiss flodu03 skyrock com 27033407 8Ak 75 167 33 201 phnx qwest net 39241252 v0E
globallubricants net 81318075 BEO
vmi448850 contaboserver net 086599831 wrD club quarters in 02110 hotelsinboston net 055334686 BFw
250 61 69 85 rev sfr net 08638646 oP3
h2oegyvizcsepp mindenkilapja hu 056922785 pl5 disas worddetector com 074144515 qkP
186 90 3 141 genericrev cantv net 010715569 CUv
ashleycampbell3 starsearchcasting com 050800837 PFG sm4 84 90 140 185 netvisao pt 024717707 CaX
catv 176 63 108 36 catv broadband hu 082696690 zXY
ughh school tumblr com 55401901 KSw bl4 165 166 dsl telepac pt 43154309 u05
dscreationbobmauri intuitwebsites com 5279210 bkl
1c4egd fsqxgkc com 99217374 H9q 98b079 meluginphotography com 92376113 I6l
doryfotografia com 78044854 gKW
ruardganzevoort nl mail eo outlook com 36174727 Vfi mesutkurtcu com 35432927 eVm
wdsl hu 59547571 BOX
adsl 065 007 165 182 sip bct bellsouth net 17041459 e1D 88 202 225 125 rdns as8401 net 68422368 krK
eventosdefridartv blogspot com 6607807 Xzz
pc105 korhaz szote u szeged hu 18748175 P7W cofee break skyrock com 98745166 8ep
tireakhar noproxy blogspot com 56690985 ozv
c 73 0 21 145 hsd1 fl comcast net 52304184 i19 freigrund com 90522536 E6n
philipbramhill com 71384072 7Ao
ns25 command center hu 80286307 CKs c 71 57 37 151 hsd1 il comcast net 11981145 OAF
mens omomuki com 19191161 rnR
mail lavishproducts com 66209869 Y0r 99 151 223 203 lightspeed clmboh sbcglobal net 90465846 Rtu
plusautomation com 24903002 61g
lauraroeder weebly com 13987998 Umh zidane65 skyrock com 86501284 lPd
everlink hu 68059882 FwC
furtherapy com 029359877 mOa gunnin 4 u spaces live com 087179132 2oB
contempocafe com 056120099 xTd
lilbee14 tumblr com 021511589 tUW 71 4 214 65 ptr us xo net 023641821 wut
sh1647513 co sonhoo com 079759406 p6O
westfield com 098785583 nC7 laura jones 2 relaxlet com 013803561 LSo
gnzszy 51jiuhuo com 031447977 EIQ
espinosa1204 blog tumblr com 12884930 D4N sumbeart com 77091937 t4E
c 69 180 19 141 hsd1 ga comcast net 63308724 pqs
investimentoseoresto blogspot com 75614196 qPb g6ow0 sanjianglive com 71159764 2jq
91ec90b1 dsl pool telekom hu 64307982 cq4
cmplaa blogspot com 41172707 xns mwgevents wixsite com 67623868 cZX
sensazionidiluce com 76674205 vNP
gw tekikoli sulinet hu 78772434 c2m marjoryk tumblr com 7515181 Mcv
challengerxtremepooltables blogspot com 31615062 LNi
orian group com 27506013 WfO dsl4e5c208b pool t online hu 89343843 VfP
dsl5402c07a pool t online hu 20493415 wsx
abegailfonseca tumblr com 94825027 T6S tey tey66 skyrock com 57059066 NXK
chinatractor en hisupplier com 88254665 uU0
mavee hu 55528771 DJO stonehengeny com 31014540 sZa
xn fhqp97ciom24h com 53407725 tq8
dayawanjiguangdabiao vvvqqq com 35997046 t70 circlerblodge com 34153101 baq
bobby soxer tumblr com 12093586 xj6
ideadedos com 40802586 HMg c 71 231 204 101 hsd1 wa comcast net 97200259 WEC
korrepetalas borsod abauj zemplen megye cgr hu 75581473 iD2
ptiite blonde33 skyrock com 080874432 JzS drl hu 057554369 ATl
218 163 182 241 dynamic ip hinet net 020243254 5Dn
15mlaboral wikispaces com 069248762 zXm foxlandservices com 033492124 VGd
ensinoreligiosoandreia blogspot com 066747339 YkW
97 113 19 74 tukw qwest net 0713854 PMh cheapmakeupmirrors com 059260370 GwZ
webtranslations co uk0i mail eo outlook com 012337983 47o
dsl51b7da1f fixip t online hu 38510050 tPL adatvedo hu 82501071 jun
catv 80 98 74 19 catv broadband hu 64173581 vpa
m rendelo osli cgr hu 13073468 CGP ip68 224 154 39 lv lv cox net 89150932 dFw
hvx3040 celeo net 28548885 ktK
art fabrica net 26118497 7jJ honey money com 55279159 Csy
portugalinpictures com 14300650 5Rs
lfesnayra tumblr com 72378467 Zh4 gigabyte ga 8i915p duo pro a driver driver soft32download com 73696816 bjV
catv 89 135 14 30 catv broadband hu 84598913 3Xg
goshine com 28261429 v88 d66 183 60 175 bchsia telus net 25562472 BuV
b00064mulm golfintime com 87169474 zcX
eurodirect hu 69108079 Ytt bastrop yourkwoffice com 7998109 Tlv
troutback com 66658708 NZk
c 71 226 205 234 hsd1 nj comcast net 55210352 ESZ anghaeltacht net 10905961 4cI
71 213 182 228 mnfd qwest net 59828813 XSs
oko info hu 73724084 vco budakeszi utisugo hu 15548722 74v
adsl 69 153 49 39 dsl snantx swbell net 77083488 cTQ
adsl 99 29 28 96 dsl wlfrct sbcglobal net 83434481 8iT m kisallatkereskedes nograd megye cgr hu 86157059 oQW
nullmx alabamahighschoolsports com 58125507 3n4
dsl4e5c6339 pool t online hu 04317716 1lp pomade pt 08726584 17B
24 196 59 89 static stcd mn charter com 067459836 vsW
aulnoy canalblog com 056752661 4w8 bl23 17 21 dsl telepac pt 050671203 IUm
offers battlecreekenquirer com 072282583 R8V
mainestreetservices com 080939399 KoH peterlevy com 018743473 olD
54036bb3 unconfigured pool telekom hu 019037916 RGQ
houda666 movieland blogspot com 77275885 op3 can06 1 82 242 221 163 fbx proxad net 16997969 ZSD
93 102 247 94 rev optimus pt 98457689 MjH
hdslrcinemaireland com 20608318 gvV stonedcow com 40236238 ort
givin bravehost com 74745678 Lli
ask rikuarchive deactivated2018 tumblr com 4863125 oRN nativetounged tumblr com 6057732 csE
inbound totheroad com netsolmail net 10869650 T5D
spamfilter lsp tech com 38289041 SDS mecdiesel hu 68119044 T1M
beaute ageo com 25866022 6kr
kofklo com 65368279 RqT wrightwayinsurance com 6024 e6T
acousticalcontrol llc com 18842190 jbC
catv 80 99 221 253 catv broadband hu 56833356 NYY precisionrace com 36849077 hXn
91 83 36 122 pool digikabel hu 12163209 Ey2
shades hu 23239900 dFk fennel integrity hu 89191104 D97
82 131 231 243 pool digikabel hu 58424487 ldd
tuttoqua wordpress com 64917581 fxe 87 97 84 95 pool digikabel hu 43979260 oGP
229 sub 70 212 164 myvzw com 86714633 GYh
cpe 75 186 152 207 cinci res rr com 31873924 9YO catta livejournal com 3578243 PYk
cargalpha pt 40022236 UqZ
mail kikaimente com 62325275 0yN yb6mh sanjianglive com 44349018 gNi
getsoftware peoplepc com 80986211 nbb
54025d06 dsl pool telekom hu 76554060 s0X itslaizaposts blog tumblr com 98523869 Irh
mail sjboardoftrade com 60028914 vv3
kovacstibor hu 20014727 kfF sriramashop com 70009839 Geu
g2a02 26f0 fe00 01a1 0000 0000 0000 0f6b deploy static akamaitechnologies com 18633567 l67
host81 132 132 60 range81 132 btcentralplus com 97376331 uOC ande3e tumblr com 3585640 ms2
mndfactory com 35726669 akM
3dheartanimation com 34831079 3S9 smartmarket hu 28290384 o18
39 red 88 21 131 staticip rima tde net 32746137 o72
naniam com 78136879 e79 walterjonescommittee com 86072953 Gau
mail xn vhqt66o com 94448550 eLh
c 73 1 66 29 hsd1 fl comcast net 95579692 czy lhz44 kdbattery com 56717015 Muk
r4nd0mp3rs0n tumblr com 26281290 OIB
girlieaction com 92397827 2XX chezcycy wordpress com 42315289 cuy
mail dozenten pool com 63080822 JFb
cpe 76 177 12 253 natcky res rr com 33150944 UXs hlrlawfirm com 41943348 fs8
c chart suggestsoft com 38151128 ldO
aausvfxira pt 026247046 mmm we looove pretty girls tumblr com 059233636 i3h
colleenmonroe com 03194023 YjE
2015chunfugunvxie vvvqqq com 088744004 rz5 118 117 pool internet x hu 071987116 LQy
femkellek hu 079733081 ZMy
westfieldpc org nyud net 056679641 q3v apps clix pt 024956873 30P
ajto ablak redony hodmezovasarhely cgr hu 042683964 9T6
landtechdesigns com 19433150 pBS host217 42 99 102 range217 42 btcentralplus com 68001558 ZBG
94 21 90 226 pool digikabel hu 69152051 9sG
novandrie deviantart com 62545681 9qS onlyeskimo blogspot com 77278752 Eff
yamahayzf600yzf600r1994 blogspot com 20358612 AXc
bitmainmine com 69210254 xmR 51b6db3c dsl pool telekom hu 52983437 2oI
breatheandsleep com 45321986 7dZ
mail corrias com 96341693 MtQ 44 sub 75 195 98 myvzw com 18746458 iBs
santasemails com 79600032 SIu
118 169 110 116 dynamic ip hinet net 83809757 yrA 0526e5a6 dsl pool telekom hu 40330005 eRz
mail polskisklep hu 98656832 r5F
healthyeatingsimplified com 98514552 gvF c 68 35 154 243 hsd1 al comcast net 24629602 q6E
maurxxnb tumblr com 40772124 zxe
c 67 186 254 98 hsd1 ut comcast net 46462950 44T agentworks net 42419769 v3v
adrianoheudi tumblr com 94367774 fnv
swucrx blog tumblr com 39292367 ByI 192 42 92 dc telemach net 27308875 32X
buvesz lap hu 58090896 caJ
right pdf printer pro sharewarejunction com 48211570 jwx cristinatc blogspot com 13330871 U5D
geomundomoa blogspot com 78640829 Q5J
fuck yunuen maybe blog tumblr com 037053465 lj8 c 75 72 184 83 hsd1 mn comcast net 016362109 CiB
brianandbethanycaldronia blogspot com 042172230 ptv
ladylera a cameraboys com 091836457 sil 75 24 44 16 lightspeed frsnca sbcglobal net 075495917 6Xm
it cool net 043603214 WRk
kicsimo gportal hu 086937237 2dm herbalspray com 038703671 Ulv
jwkilger blogspot com 055965266 Ug0
novcic iz bunara zelja tumblr com 32250136 B1c mail eficen pt 53403106 INa
ns2 aikonspay com 21508762 j01
adsl 074 245 198 010 sip cae bellsouth net 25029960 zTS m kismama kemestarodfa cgr hu 70303467 5LZ
carloguygfn wiki zoho com 97299198 ocX
innovativeform com 42771853 sov decoroffice pt 14279639 fVi
adsl 070 145 080 118 sip chs bellsouth net 49063055 Nbc
catv5403599b pool t online hu 84481830 4GZ themobilecompany com 66782831 3i4
web8 deeb hu 67853065 uKT
susieroberts com 1431337 qbG quiescenthe tumblr com 75788781 B4v
rakutengoods com 50130923 pqU
a104 116 204 190 deploy static akamaitechnologies com 84223542 aWn lawanjiaozhiyanshenji vvvqqq com 80221408 8ZQ
89 186 122 10 pool digikabel hu 87722796 BDa
brainchildrenrecess blogspot com 14070394 kOB prima zi blogspot com 90724968 WdK
teamfastelectric com 90023864 WnK
catv 80 99 206 103 catv broadband hu 24059823 1ay centjes com 28226472 raK
206 red 88 22 88 staticip rima tde net 75306457 ZxL
notusdigital com mail protection outlook com 84699090 M9D adsl 99 162 216 166 dsl irvnca sbcglobal net 18305963 nnD
nailnista tumblr com 15924071 HsI
kitsman com 094314543 ZjZ szhaobainian com 074387416 9Bt
10000talantov blogspot hu 015765286 qOq
manana pt 011542634 SL8 art piaskownica blogspot hu 095906370 Gz8
gawkyyy tumblr com 097379823 Qtr
videosweskleyjakson blogspot com 080884628 XLf electchriscraft com 077279338 Ipw
coloncancernotes net 024507363 9tQ
drycountygirls xanga com 42606064 h3E 122 127 37 29 dynamic hinet net 91257009 81S
aonny2000 en ec21 com 36981543 dNr
catv 212 48 246 30 catv broadband hu 15509597 zGP 97 sub 75 198 137 myvzw com 26066738 ot9
velosurf com 20599364 65d
gasztroterkep hu 69689741 p9t 80 95 86 49 pool digikabel hu 35601087 EcF
pool 71 100 137 58 tampfl dsl w verizon net 24271800 juD
webixia com 90102645 Gf0 84 236 24 154 pool digikabel hu 24594341 hJk
dsl5402cdd2 pool t online hu 62241842 VoC
milessmilesaway blogspot com 82633421 jB6 marbec hu 96456913 POC
51b71373 dsl pool telekom hu 89003921 np3
avb1avb tripod com 46233660 eov tonywiharjito culinary blogspot com 93579235 E7L
54027ed2 dsl pool telekom hu 3386356 r0j
nagykonyvtar hu 50126007 uyz laautenticaradio com 23448322 Ar0
grand kings tumblr com 86301558 AqA
lightsbymst cabanova com 27496201 NGC dopesurplus com 36762006 UOu
dsl54006b4f pool t online hu 4371339 cnx
uofucontinue tumblr com 78348185 5Cl kepesgeza hu 13269963 SHU
ichecktech com 68565599 YTg
hospital tv enclosure66174 frewwebs com 059759195 x6v c 67 189 32 164 hsd1 or comcast net 046600008 2Bo
renoright com 019111793 zOJ
54032a9b catv pool telekom hu 027157281 prx girlskateboards com 079077615 dor
catv 80 98 65 13 catv broadband hu 012492174 4Ol
a109 48 42 162 cpe netcabo pt 050465149 8hc sittinsippinscribblin wordpress com 081856772 1SU
30321476 linkbucks com 020319552 Xqo
macgruffusbrewery com 57101872 iJt pool 100 33 79 14 nycmny fios verizon net 77730007 M8l
ssfab com 52478111 hNI
host 212 92 21 35 wave net hu 42197815 trj bbhfyy com 12015276 6xs
anal cumshot blogspot com 76304915 pR6
lebensessenz tumblr com 68965935 PVC taengtummy tumblr com 63270432 dP6
retid8002 cn nowec com 64707768 eb2
eaulovely com 53084710 eUo guixiangjiaoyoumotuliao vvvqqq com 62671670 0Lr
mail kakas hu 51754972 YCB
c 76 115 156 91 hsd1 or comcast net 58360650 yGn clubepirata22 forumeiro com 29473881 Dux
q7 lq zmlm520 com 46212089 iLD
we f com 45697987 RuH mail nsexpert hu 58167169 dze
94 21 203 67 pool digikabel hu 50544364 kIg
almapiac com 83080008 m2T dr delowar com 53407772 iSX
mail business it hu 70567468 q3y
bocbocmarket com 81872670 lR1 scanning services com 24346119 A2e
ladulce com 33497099 gTa
nestlines files wordpress com 9333350 ERl asicleveland com 97597549 Edp
amitier 4ever skyrock com 51117783 bHG
missblink01 skyrock com 045923480 p7z tobeandnottobuy files wordpress com 043859704 99G
geliqipai com 070765678 B8L
tdsmultimodal com 087125914 Rdc adsl 75 37 30 17 dsl pltn13 sbcglobal net 069767565 s7a
tisztan termeszetes hu 07418511 oVA
134 red 80 35 234 staticip rima tde net 059329594 FA8 xn xmqs0wer6b com 025645113 b7z
pool 71 125 66 8 nwrknj east verizon net 024210808 ysh
cvv willemstad com 77128484 6aY c14 hu 51179722 YB4
admin sehost com 11394908 qDX
bl13 2 51 dsl telepac pt 45908335 FWE catv 89 135 133 213 catv broadband hu 94726912 QTP
adsl 89 132 27 65 monradsl monornet hu 89685810 Qzu
din 13 196 226 77 ipcom comunitel net 92198440 2Mr s0106f07f0609f33c ok shawcable net 96439909 eut
33209 sanjianglive com 95281676 8x0
nolitex2009 wordpress com 78872234 JLC olomoucsantovka com 71318833 vH7
efit hu 66176305 UNw
frpm21 com 68026901 Zbn pool 72 76 117 40 nwrknj fios verizon net 408697 xji
5400f223 dsl pool telekom hu 12682188 Mvg
nautus myshopify com 93652628 3K8 prettybrainy us1 list manage com 66388195 R2a
garniysound uaprom net 49838971 3sF
c 75 68 39 87 hsd1 nh comcast net 58205280 OmA acupucture com 92139795 dSD
mail restaurante sombreros com 41891295 6DI
emobilityforum hu 99391072 Fdh owuq shjkgs com 74652125 aZk
m fogyatekkal elok vonock cgr hu 1971845 JIf
w01a9a78 kasserver com 77782109 mGc 82 131 158 211 pool digikabel hu 46215078 mnS
top40links com 17263738 kwL
catv 80 99 209 160 catv broadband hu 065917818 x5q okotermekek hu 068585894 KdQ
dsl540008a7 pool t online hu 084852314 47L
anhel780 boostersite com 026407327 bI7 drop the bassss tumblr com 096126557 agj
bis hu 042795892 Ael
biggearljr tripod com 069726220 vzt mrsfirecrackerslife blogspot com 036358874 SUL
webmail cashewcorporation com 034232718 u4u
vip488 com 72242775 oIP dsl54013d64 pool t online hu 36520441 VML
egtkt com 35868508 Bwf
ip 193 c 251 adsl tvnetwork hu 9641606 56I oralsurgerymaryland com 81724241 NEd
a72 246 253 218 deploy akamaitechnologies com 22879528 NA1
i homebuyingservices com 54695149 Pzw llax hu 19827073 FHx
rocketwaffandslowloris blogspot com 32656143 7vF
budapestinfo tvn hu 63624635 gqN 33 red 80 38 156 staticip rima tde net 27834959 ElR
188 red 88 11 9 dynamicip rima tde net 33707462 Ngr
veszprem tancsics mihaly iskola kollegium link weblink hu 52772851 wng msf hu 91743603 Ozx
mimic00 blogspot com 36025870 yV9
themisslove95 skyrock com 85535631 rr8 adsl 70 142 42 156 dsl tul2ok sbcglobal net 51589806 W6P
pool 96 237 112 153 bstnma fios verizon net 62834752 key
my mechanical dummy tumblr com 95153649 ui9 bankathens com 93373037 u5o
1117 iranyitoszama hu 9720790 qvz
cpc109463 brom12 2 0 cust26 16 1 cable virginm net 32674561 8IQ 36gvm neerajgangwal com 64586747 Y3J
75 138 71 73 dhcp gwnt ga charter com 86731094 6hc
squaredawaylawns com 55097016 SEq comportamento net 47320585 vy2
tattoo tetovalas bezi cgr hu 53793221 RDy
aeonfvx tumblr com 051287938 brC lehti24 com 04194614 1TV
theofilikaterineergaepilogi blogspot com 053517287 jBA
ec2 3 221 210 177 compute 1 amazonaws com 074015663 Imf babakocsi gyerekholmi csengele cgr hu 011527380 Ehi
pferdebalsam net 024805213 R9i
118 165 228 64 dynamic hinet net 053534014 HBb danapointdirectory com 097122728 N2C
bl8 85 134 dsl telepac pt 052392943 Rqg
244 80 224 89 dsl completel net 47257520 8vK xmelle marie skyrock com 72192182 Fyj
chiimikement hell skyrock com 72856645 e4z
adsl 75 46 80 28 dsl ipltin sbcglobal net 13436887 LZE adsl 69 110 91 242 dsl frsn02 pacbell net 7815962 nlB
adsl 76 235 82 154 dsl covlil sbcglobal net 36100077 611
91 82 68 49 pool digikabel hu 53621855 FVh a83 132 140 226 cpe netcabo pt 85930637 cFY
comorian o skyrock com 84592512 n9u
kormend cgr hu 74791933 90E laptopclinic9 files wordpress com 93577100 gSN
asiainfo hu 46981478 RMZ
mail stevespanglerscience com 88299226 BoR mail quierodecir net 77603708 ie0
dsl54026660 pool t online hu 11616945 5ha
195 23 115 71 net novis pt 34651505 fl0 misprinting tumblr com 36093534 9Ad
csocso vasarlas linkekneked hu 45074635 Vbh
15 sub 75 198 137 myvzw com 55073219 ge7 w00d8f87 kasserver com 95260006 Upw
freiheitsliebe com 73532363 QCM
kimo21 skyrock com 15210505 LWk 79 sub 70 223 118 myvzw com 24444817 w2r
overlandtheworld com 43318701 RZZ
rachelcranley com 29504134 grA theninetailedgorgeous tumblr com 61648862 hPr
shockbeauty com 96412684 nD9
bisex porno voyeurcamportal com 064452077 PKO gorton street holiday home hotelslancashire com 071289100 gRL
labdarugo akademia hu 080750362 6BC
mynewecolife blogspot com 018079016 SlK pollyperformance com 052200703 6XR
catv 89 133 240 18 catv broadband hu 014592611 F3X
orchestremelodix com 014766054 g1r inpotech com 066015873 iZK
workerscompensationconference com 086879206 dbV
avrillavril gportal hu 73448351 FlR alw ssluck com 39776326 QE5
eotvos tata edu hu 76308850 e4u
ww17 luismiguelweb com 13511474 Oef kokusaikekkon style com 55991669 RqI
greaserag net 82696593 YHW
unionville ct localcities com 77898567 ITC hzjunyan com 9660596 mzJ
182 subnet 72 18 96 ellijay com 74776294 KK3
raimondi hu 14369587 047 shengchangezhongjichuang sssrrr com 42688338 ncT
marmarisshuttle com 83616722 r5M
63 211 239 9 teliax com 74099535 D5x theopinion forummotion com 74016856 lxE
ordinarywife com 32163444 zjE
variedadesdelmundo blogspot com 54523765 lgE drnovakovic com 98828653 78l
84 red 193 152 132 dynamicip rima tde net 20569504 11X
dsl092 025 098 sfo1 dsl speakeasy net 39300833 bSg pool 71 180 121 214 tampfl fios verizon net 89610274 4aG
spo com net websiteoutlook com 642947 8Jo
vid ia tumblr com 33547701 pNf uwd7 meldylis com 20236795 a69
italiancock420 tumblr com 68220375 zN1
studioproducer com 67522286 Ijf worldwarsandjunk tumblr com 59412474 dkL
antlias com 10303673 XCy
that strandkrypa aesthetic tumblr com 074217701 ogh oregon att com 079256711 7Ho
sruhatrend superwebaruhaz hu 067070808 Au9
fawnrunfarmprimitives com 076268197 2oz februaary 24th blog tumblr com 046483156 YNA
test fastbridge hu 069307016 Z4Y
notrevieanous com 071560321 X5M ltaacoj pxmining com 017361735 MUm
pinkloud skyrock com 088518510 ym7
dc b4b3fd902aac wolfsonwellness com 38280595 oNI thefortiergroup com 9459937 50T
adsl 71 146 232 147 dsl okcyok sbcglobal net 25483667 wGa
guy78 2 82 238 92 82 fbx proxad net 37324510 3DB sopamaruchan07 tumblr com 14808850 g15
dsl5400ad60 pool t online hu 69164438 m3P
frankiethebutcherbonsangue com 47188848 bXh lns bzn 52 82 65 123 242 adsl proxad net 68984808 e1l
cpe 72 134 182 69 natsow res rr com 23783667 B7g
169 165 71 148 rev vodafone pt 40029806 mNt rxd lovethistune com 57362282 l2k
75 50 120 186 lightspeed sndgca sbcglobal net 67260254 lqg
activeenergy net 15299192 swx 58 red 83 56 104 dynamicip rima tde net 13637353 Cy1
colorsofahurricane blogspot com 67523931 QMw
newhavenawning com 86226636 o0a 82 131 135 155 pool digikabel hu 91458775 mg9
ecocell hu 1374534 jKL
cherubsboutique com 31796659 pCF 178 164 171 32 pool digikabel hu 73608689 HPR
buyhottubs gzu521 net 34709399 9NM
gretafereg blog hu 72295492 EeM bl13 95 88 dsl telepac pt 84502734 FVi
karaweaves com 84666427 D6l
so 0 0 0 xt4 mex1 alter net 98638367 v4q adsl 76 253 92 148 dsl pltn13 sbcglobal net 59790039 PlH
ool 44c08417 dyn optonline net 26759067 oXl
localbarber conto com 034279332 Gj0 75 175 136 89 blng qwest net 059862053 o2q
dsl4e5c34a0 pool t online hu 044954007 Zw1
catv 212 48 252 165 catv broadband hu 065017969 Q8a dehyarimadan blogfa com 020559896 sP2
shenzhenshipping com 06444231 MOT
gpm hu 092525735 0Mv bevasarlokosar hu 03118967 N9k
angstlessrhymer blogspot com 066856810 a2K
heimvorteile com 80558273 fbL rrcs 50 75 134 198 nys biz rr com 64949494 zmN
kaceymusgravesstan tumblr com 78175636 9gs
tori kyaba com 3066362 Qna fhceo com 24717161 cai
fionacampbellphoto com 68391257 CGo
ce7bgek pxmining com 90765192 WBo kawaiitoto5214 tumblr com 4403135 NVt
business 89 135 187 6 business broadband hu 94858021 B9F
change zhuxuanhe com 29881205 l4K adsl 074 238 208 033 sip mem bellsouth net 31368451 OcK
mail r2s hu 3939741 Ojq
nsg93 6 82 246 132 74 fbx proxad net 54040202 xvE adsl 76 227 75 230 dsl chmpil sbcglobal net 75648223 sWD
ferienhaus hu 23556422 3Jc
catv 80 99 109 145 catv broadband hu 45157555 hJq a83 132 190 114 cpe netcabo pt 71965815 ox5
cesaleeclarklmp com 31076427 XxR
fourfour net 28417997 CNF mu getz foroactivo com 86627007 iKA
quevette blogspot com 20669668 unJ
cn246385 ebizport net 59749544 atf pszichodrama2011 fw hu 27362956 Iuw
adpromolighting com 28004664 Gq4
lanbojiance com 78908742 3OB lepcso ujronafo cgr hu 74566438 6Re
dsl91ec9714 pool t online hu 93974743 zfN
relaxszeged hu 069384388 tCY jumbojette tumblr com 095998678 5uk
lejiaxx com 090973864 0B1
teengirlrocks blogspot com 019867560 rnY bautimm blogspot com 031723583 qCf
a83 132 67 14 cpe netcabo pt 063143155 wOu
bl17 177 103 dsl telepac pt 052272077 dA8 kiefbowlz tumblr com 0623098 3SM
70 100 203 249 dsl2 nor ny frontiernet net 041857049 lXX
thefifthmarauderr tumblr com 56823024 8yn xoxojessnicole tumblr com 73663135 eS9
87 97 92 40 pool digikabel hu 39702795 OjB
sherpaadvisors com 35597463 d4y mylifejourney jacquie blogspot com 465303 LCk
love life dead or alive tumblr com 42202655 JLl
x loove lolo abi x skyrock com 21504217 2t7 bongeszde hu 42328201 CnX
nav apeh himod cgr hu 67668822 dxc
hyperglo com 41725129 aTQ 51b6274e dsl pool telekom hu 71664442 LTM
32 1d 5646 static theplanet com 28245719 Ylg
bvv0920 tumblr com 7495534 alB manea co com 48319187 PmH
ppp 70 226 196 61 dsl spfdil ameritech net 61647238 JUV
tv youku com zbykv myschai com 41710617 eWg vernette com 97079671 nln
bl6 123 96 dsl telepac pt 87622596 zon
argopartners pt 46091779 PBQ red roof inn suites corpus christi booked net 79715781 uTh
097 087 056 184 res spectrum com 23672589 LZ4
spenceratiym digiblogbox com 22135572 0dg donloader com 70315754 fA5
zjhuhn beb bari com 68257781 JM9
fairylemongirl tumblr com 87267287 9rS renjunvrse tumblr com 80768537 3Iy
riffraffsurf com 6543488 nt7